Anti-HSPB8 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-HSPB8 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA015876
• Supplier Catalog Number: HPA015876
• Alternative Catalog Number: ATA-HPA015876-100,ATA-HPA015876-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: E2IG1, H11, HSP22, HspB8

Product Description

heat shock 22kDa protein 8

Additional Information

Anti-HSPB8

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 26353
• UniProt: Q9UJY1
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: HSPB8
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.

Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HSPB8 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Western blot analysis in control (vector only transfected HEK293T lysate) and HSPB8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415329).

HPA015876

HPA015876

HPA015876