Anti-CTNND1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA015954
Artikelname: Anti-CTNND1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA015954
Hersteller Artikelnummer: HPA015954
Alternativnummer: ATA-HPA015954-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CTNND, KIAA0384, p120, p120cas, p120ctn
catenin (cadherin-associated protein), delta 1
Anti-CTNND1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 1500
UniProt: O60716
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CTNND1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human parathyroid gland and skeletal muscle tissues using Anti-CTNND1 antibody. Corresponding CTNND1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human parathyroid gland shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell lines A-431 and HEK293 using Anti-CTNND1 antibody. Corresponding CTNND1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Western blot analysis using Anti-CTNND1 antibody HPA015954 (A) shows similar pattern to independent antibody HPA015955 (B).
HPA015954
HPA015954
HPA015954