Anti-CTNND1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CTNND1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA015954
• Supplier Catalog Number: HPA015954
• Alternative Catalog Number: ATA-HPA015954-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CTNND, KIAA0384, p120, p120cas, p120ctn

Product Description

catenin (cadherin-associated protein), delta 1

Additional Information

Anti-CTNND1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 1500
• UniProt: O60716
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: ETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFH
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CTNND1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunohistochemistry analysis in human parathyroid gland and skeletal muscle tissues using Anti-CTNND1 antibody. Corresponding CTNND1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human parathyroid gland shows high expression.

Immunohistochemical staining of human skeletal muscle shows low expression as expected.

Western blot analysis in human cell lines A-431 and HEK293 using Anti-CTNND1 antibody. Corresponding CTNND1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Western blot analysis using Anti-CTNND1 antibody HPA015954 (A) shows similar pattern to independent antibody HPA015955 (B).

HPA015954

HPA015954

HPA015954