Anti-MGARP Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA015994
Artikelname: Anti-MGARP Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA015994
Hersteller Artikelnummer: HPA015994
Alternativnummer: ATA-HPA015994-100,ATA-HPA015994-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C4orf49, CESP-1, HUMMR, OSAP
mitochondria-localized glutamic acid-rich protein
Anti-MGARP
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 84709
UniProt: Q8TDB4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YKTVTSDQAKHTEHKTNLKEKTKAEIHPFQGEKENVAETEKASSEAPEELIVEAEVVDAEESPSATVVVIKEASACPGHVEAAPETTAVSAETGPEVTDAAA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MGARP
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000
Immunofluorescent staining of human cell line BJ shows localization to mitochondria.
Immunohistochemistry analysis in human adrenal gland and cerebral cortex tissues using Anti-MGARP antibody. Corresponding MGARP RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human adrenal gland shows high expression.
Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
HPA015994
HPA015994
HPA015994