Anti-MGARP Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA015994
- Images (9)
| Article Name: | Anti-MGARP Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA015994 |
| Supplier Catalog Number: | HPA015994 |
| Alternative Catalog Number: | ATA-HPA015994-100,ATA-HPA015994-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C4orf49, CESP-1, HUMMR, OSAP |
| mitochondria-localized glutamic acid-rich protein |
| Anti-MGARP |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 84709 |
| UniProt: | Q8TDB4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YKTVTSDQAKHTEHKTNLKEKTKAEIHPFQGEKENVAETEKASSEAPEELIVEAEVVDAEESPSATVVVIKEASACPGHVEAAPETTAVSAETGPEVTDAAA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MGARP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000 |
|
|
Immunofluorescent staining of human cell line BJ shows localization to mitochondria. |
|
|
Immunohistochemistry analysis in human adrenal gland and cerebral cortex tissues using Anti-MGARP antibody. Corresponding MGARP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adrenal gland shows high expression. |
|
|
Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
HPA015994 |
|
|
|
|
|
HPA015994 |
|
|
HPA015994 |
Product Guarantee and Expert Support
