Anti-HSD17B12
Artikelnummer:
ATA-HPA016427
- Bilder (8)
| Artikelname: | Anti-HSD17B12 |
| Artikelnummer: | ATA-HPA016427 |
| Hersteller Artikelnummer: | HPA016427 |
| Alternativnummer: | ATA-HPA016427-100,ATA-HPA016427-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KAR, SDR12C1 |
| hydroxysteroid (17-beta) dehydrogenase 12 |
| Anti-HSD17B12 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 51144 |
| UniProt: | Q53GQ0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | WGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIYDKIKTGLAGLEIGILVNNVGMSYEYPEYFLDVPDLD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HSD17B12 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells. |
|
|
Western blot analysis in human cell lines U-251MG and HeLa using Anti-HSD17B12 antibody. Corresponding HSD17B12 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
HPA016427-100ul |
|
|
HPA016427-100ul |
|
|
HPA016427-100ul |
Produktgarantie und fachkundiger Support
