Anti-HSD17B12
Catalog Number:
ATA-HPA016427
- Images (8)
| Article Name: | Anti-HSD17B12 |
| Biozol Catalog Number: | ATA-HPA016427 |
| Supplier Catalog Number: | HPA016427 |
| Alternative Catalog Number: | ATA-HPA016427-100,ATA-HPA016427-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KAR, SDR12C1 |
| hydroxysteroid (17-beta) dehydrogenase 12 |
| Anti-HSD17B12 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 51144 |
| UniProt: | Q53GQ0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | WGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIYDKIKTGLAGLEIGILVNNVGMSYEYPEYFLDVPDLD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HSD17B12 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells. |
|
|
Western blot analysis in human cell lines U-251MG and HeLa using Anti-HSD17B12 antibody. Corresponding HSD17B12 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
HPA016427-100ul |
|
|
HPA016427-100ul |
|
|
HPA016427-100ul |
Product Guarantee and Expert Support
