Anti-TMTC4 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA016489
Artikelname: Anti-TMTC4 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA016489
Hersteller Artikelnummer: HPA016489
Alternativnummer: ATA-HPA016489-100,ATA-HPA016489-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ14624, FLJ22153
transmembrane and tetratricopeptide repeat containing 4
Anti-TMTC4
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 84899
UniProt: Q5T4D3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TMTC4
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in glomeruli.
Immunohistochemical staining of human fallopian tube shows strong membranous positivity in endothelial cells.
Immunohistochemical staining of human skeletal muscle shows strong membranous positivity in endothelial cells.
HPA016489
HPA016489
HPA016489