Anti-TMTC4 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-TMTC4 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA016489
• Supplier Catalog Number: HPA016489
• Alternative Catalog Number: ATA-HPA016489-100,ATA-HPA016489-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ14624, FLJ22153

Product Description

transmembrane and tetratricopeptide repeat containing 4

Additional Information

Anti-TMTC4

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 84899
• UniProt: Q5T4D3
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: NLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLR
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: TMTC4
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.

Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in glomeruli.

Immunohistochemical staining of human fallopian tube shows strong membranous positivity in endothelial cells.

Immunohistochemical staining of human skeletal muscle shows strong membranous positivity in endothelial cells.

HPA016489

HPA016489

HPA016489