Anti-MYL3
Artikelnummer:
ATA-HPA016564
- Bilder (8)
| Artikelname: | Anti-MYL3 |
| Artikelnummer: | ATA-HPA016564 |
| Hersteller Artikelnummer: | HPA016564 |
| Alternativnummer: | ATA-HPA016564-100,ATA-HPA016564-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CMH8, MLC1SB, MLC1V, VLC1 |
| myosin, light chain 3, alkali, ventricular, skeletal, slow |
| Anti-MYL3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4634 |
| UniProt: | P08590 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEM |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MYL3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human heart muscle and lymph node tissues using HPA016564 antibody. Corresponding MYL3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
Immunohistochemical staining of human lymph node shows no positivity in non-germinal center cells as expected. |
|
|
Immunohistochemical staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes. |
|
|
HPA016564-100ul |
|
|
HPA016564-100ul |
|
|
HPA016564-100ul |
Produktgarantie und fachkundiger Support
