Anti-MYL3
Catalog Number:
ATA-HPA016564
- Images (8)
| Article Name: | Anti-MYL3 |
| Biozol Catalog Number: | ATA-HPA016564 |
| Supplier Catalog Number: | HPA016564 |
| Alternative Catalog Number: | ATA-HPA016564-100,ATA-HPA016564-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CMH8, MLC1SB, MLC1V, VLC1 |
| myosin, light chain 3, alkali, ventricular, skeletal, slow |
| Anti-MYL3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4634 |
| UniProt: | P08590 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEM |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MYL3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human heart muscle and lymph node tissues using HPA016564 antibody. Corresponding MYL3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
Immunohistochemical staining of human lymph node shows no positivity in non-germinal center cells as expected. |
|
|
Immunohistochemical staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes. |
|
|
HPA016564-100ul |
|
|
HPA016564-100ul |
|
|
HPA016564-100ul |
Product Guarantee and Expert Support
