Anti-ORAI1

Artikelnummer: ATA-HPA016583
Artikelname: Anti-ORAI1
Artikelnummer: ATA-HPA016583
Hersteller Artikelnummer: HPA016583
Alternativnummer: ATA-HPA016583-100,ATA-HPA016583-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CRACM1, FLJ14466, TMEM142A
ORAI calcium release-activated calcium modulator 1
Anti-ORAI1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: None
UniProt: None
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHYA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ORAI1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemical staining of human skin shows membranous positivity in squamous epithelial cells.
Western blot analysis in human cell line NB4.
Western blot analysis in control (vector only transfected HEK293T lysate) and ORAI1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403208).
HPA016583-100ul
HPA016583-100ul
HPA016583-100ul