Anti-ORAI1

Catalog Number: ATA-HPA016583
Article Name: Anti-ORAI1
Biozol Catalog Number: ATA-HPA016583
Supplier Catalog Number: HPA016583
Alternative Catalog Number: ATA-HPA016583-100,ATA-HPA016583-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CRACM1, FLJ14466, TMEM142A
ORAI calcium release-activated calcium modulator 1
Anti-ORAI1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: None
UniProt: None
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHYA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ORAI1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemical staining of human skin shows membranous positivity in squamous epithelial cells.
Western blot analysis in human cell line NB4.
Western blot analysis in control (vector only transfected HEK293T lysate) and ORAI1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403208).
HPA016583-100ul
HPA016583-100ul
HPA016583-100ul