Anti-ASL
Artikelnummer:
ATA-HPA016646
- Bilder (7)
| Artikelname: | Anti-ASL |
| Artikelnummer: | ATA-HPA016646 |
| Hersteller Artikelnummer: | HPA016646 |
| Alternativnummer: | ATA-HPA016646-100,ATA-HPA016646-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ASL |
| argininosuccinate lyase |
| Anti-ASL |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 435 |
| UniProt: | P04424 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDED |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ASL |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human liver shows moderate nuclear and cytoplasmic positivity in hepatocytes. |
|
|
Western blot analysis in human cell lines A-431 and HEK293 using Anti-ASL antibody. Corresponding ASL RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell line HepG2. |
|
|
HPA016646-100ul |
|
|
|
|
|
HPA016646-100ul |
|
|
HPA016646-100ul |
Produktgarantie und fachkundiger Support
