Anti-ASL
Catalog Number:
ATA-HPA016646
- Images (7)
| Article Name: | Anti-ASL |
| Biozol Catalog Number: | ATA-HPA016646 |
| Supplier Catalog Number: | HPA016646 |
| Alternative Catalog Number: | ATA-HPA016646-100,ATA-HPA016646-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ASL |
| argininosuccinate lyase |
| Anti-ASL |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 435 |
| UniProt: | P04424 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDED |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ASL |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human liver shows moderate nuclear and cytoplasmic positivity in hepatocytes. |
|
|
Western blot analysis in human cell lines A-431 and HEK293 using Anti-ASL antibody. Corresponding ASL RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell line HepG2. |
|
|
HPA016646-100ul |
|
|
|
|
|
HPA016646-100ul |
|
|
HPA016646-100ul |
Product Guarantee and Expert Support
