Anti-TREML1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA016700
Artikelname: Anti-TREML1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA016700
Hersteller Artikelnummer: HPA016700
Alternativnummer: ATA-HPA016700-100,ATA-HPA016700-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: dJ238O23.3, TLT1
triggering receptor expressed on myeloid cells-like 1
Anti-TREML1
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 340205
UniProt: Q86YW5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KRKQGNRLGVCGRFLSSRVSGMNPSSVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPAQNPPNNQTPSS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TREML1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human bone marrow and colon tissues using Anti-TREML1 antibody. Corresponding TREML1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human bone marrow, colon, kidney and testis using Anti-TREML1 antibody HPA016700 (A) shows similar protein distribution across tissues to independent antibody HPA017860 (B).
Immunohistochemical staining of human bone marrow shows high expression.
Immunohistochemical staining of human colon shows low expression as expected.
Immunohistochemical staining of human testis using Anti-TREML1 antibody HPA016700.
Immunohistochemical staining of human kidney using Anti-TREML1 antibody HPA016700.
HPA016700
HPA016700
HPA016700