Anti-TREML1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-TREML1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA016700
• Supplier Catalog Number: HPA016700
• Alternative Catalog Number: ATA-HPA016700-100,ATA-HPA016700-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: dJ238O23.3, TLT1

Product Description

triggering receptor expressed on myeloid cells-like 1

Additional Information

Anti-TREML1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 340205
• UniProt: Q86YW5
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KRKQGNRLGVCGRFLSSRVSGMNPSSVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPAQNPPNNQTPSS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: TREML1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500

Images

Immunohistochemistry analysis in human bone marrow and colon tissues using Anti-TREML1 antibody. Corresponding TREML1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human bone marrow, colon, kidney and testis using Anti-TREML1 antibody HPA016700 (A) shows similar protein distribution across tissues to independent antibody HPA017860 (B).

Immunohistochemical staining of human bone marrow shows high expression.

Immunohistochemical staining of human colon shows low expression as expected.

Immunohistochemical staining of human testis using Anti-TREML1 antibody HPA016700.

Immunohistochemical staining of human kidney using Anti-TREML1 antibody HPA016700.

HPA016700

HPA016700

HPA016700