Anti-TREML1

Catalog Number: ATA-HPA016700
Article Name: Anti-TREML1
Biozol Catalog Number: ATA-HPA016700
Supplier Catalog Number: HPA016700
Alternative Catalog Number: ATA-HPA016700-100,ATA-HPA016700-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: dJ238O23.3, TLT1
triggering receptor expressed on myeloid cells-like 1
Anti-TREML1
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 340205
UniProt: Q86YW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KRKQGNRLGVCGRFLSSRVSGMNPSSVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPAQNPPNNQTPSS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TREML1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human bone marrow and colon tissues using Anti-TREML1 antibody. Corresponding TREML1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human bone marrow, colon, kidney and testis using Anti-TREML1 antibody HPA016700 (A) shows similar protein distribution across tissues to independent antibody HPA017860 (B).
Immunohistochemical staining of human bone marrow shows high expression.
Immunohistochemical staining of human colon shows low expression as expected.
Immunohistochemical staining of human testis using Anti-TREML1 antibody HPA016700.
Immunohistochemical staining of human kidney using Anti-TREML1 antibody HPA016700.
HPA016700-100ul
HPA016700-100ul
HPA016700-100ul