Anti-SLC15A4 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA016713
- Bilder (9)
| Artikelname: | Anti-SLC15A4 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA016713 |
| Hersteller Artikelnummer: | HPA016713 |
| Alternativnummer: | ATA-HPA016713-100,ATA-HPA016713-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PHT1, PTR4 |
| solute carrier family 15 (oligopeptide transporter), member 4 |
| Anti-SLC15A4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 121260 |
| UniProt: | Q8N697 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC15A4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human endometrium shows moderate to strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong positivity. |
|
|
Immunohistochemical staining of human colon shows moderate to strong positivity in glandular cells. |
|
|
|
|
|
HPA016713 |
|
|
HPA016713 |
|
|
HPA016713 |
Produktgarantie und fachkundiger Support
