Anti-SLC15A4

Artikelnummer: ATA-HPA016713
Artikelname: Anti-SLC15A4
Artikelnummer: ATA-HPA016713
Hersteller Artikelnummer: HPA016713
Alternativnummer: ATA-HPA016713-100,ATA-HPA016713-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PHT1, PTR4
solute carrier family 15 (oligopeptide transporter), member 4
Anti-SLC15A4
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 121260
UniProt: Q8N697
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SLC15A4
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human endometrium shows moderate to strong membranous positivity in glandular cells.
Immunohistochemical staining of human lymph node shows moderate to strong positivity in lymphoid cells.
Immunohistochemical staining of human testis shows moderate to strong positivity.
Immunohistochemical staining of human colon shows moderate to strong positivity in glandular cells.
HPA016713-100ul
HPA016713-100ul
HPA016713-100ul