Anti-SLC15A4 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA016713
- Images (9)
| Article Name: | Anti-SLC15A4 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA016713 |
| Supplier Catalog Number: | HPA016713 |
| Alternative Catalog Number: | ATA-HPA016713-100,ATA-HPA016713-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PHT1, PTR4 |
| solute carrier family 15 (oligopeptide transporter), member 4 |
| Anti-SLC15A4 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 121260 |
| UniProt: | Q8N697 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC15A4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human endometrium shows moderate to strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong positivity. |
|
|
Immunohistochemical staining of human colon shows moderate to strong positivity in glandular cells. |
|
|
|
|
|
HPA016713 |
|
|
HPA016713 |
|
|
HPA016713 |
Product Guarantee and Expert Support
