Anti-SLC15A4

Catalog Number: ATA-HPA016713
Article Name: Anti-SLC15A4
Biozol Catalog Number: ATA-HPA016713
Supplier Catalog Number: HPA016713
Alternative Catalog Number: ATA-HPA016713-100,ATA-HPA016713-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PHT1, PTR4
solute carrier family 15 (oligopeptide transporter), member 4
Anti-SLC15A4
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 121260
UniProt: Q8N697
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SLC15A4
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human endometrium shows moderate to strong membranous positivity in glandular cells.
Immunohistochemical staining of human lymph node shows moderate to strong positivity in lymphoid cells.
Immunohistochemical staining of human testis shows moderate to strong positivity.
Immunohistochemical staining of human colon shows moderate to strong positivity in glandular cells.
HPA016713-100ul
HPA016713-100ul
HPA016713-100ul