Anti-TMTC1
Artikelnummer:
ATA-HPA016720
- Bilder (8)
| Artikelname: | Anti-TMTC1 |
| Artikelnummer: | ATA-HPA016720 |
| Hersteller Artikelnummer: | HPA016720 |
| Alternativnummer: | ATA-HPA016720-100,ATA-HPA016720-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ARG99, FLJ31400, FLJ41625, OLF |
| transmembrane and tetratricopeptide repeat containing 1 |
| Anti-TMTC1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 83857 |
| UniProt: | Q8IUR5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GITVFGVCLVYDLFSLSNKQDKSSNGALCPRSPQQPGSPQPSSLPGHPHRENGKQQRFPHKGAWGGCHSPLPPEPKSSGFPVSPRAVWSMMR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TMTC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
|
|
|
|
|
|
HPA016720-100ul |
|
|
HPA016720-100ul |
|
|
HPA016720-100ul |
Produktgarantie und fachkundiger Support
