Anti-TMTC1

Catalog Number: ATA-HPA016720
Article Name: Anti-TMTC1
Biozol Catalog Number: ATA-HPA016720
Supplier Catalog Number: HPA016720
Alternative Catalog Number: ATA-HPA016720-100,ATA-HPA016720-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ARG99, FLJ31400, FLJ41625, OLF
transmembrane and tetratricopeptide repeat containing 1
Anti-TMTC1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 83857
UniProt: Q8IUR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GITVFGVCLVYDLFSLSNKQDKSSNGALCPRSPQQPGSPQPSSLPGHPHRENGKQQRFPHKGAWGGCHSPLPPEPKSSGFPVSPRAVWSMMR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TMTC1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA016720-100ul
HPA016720-100ul
HPA016720-100ul