Anti-ESYT1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA016858
Artikelname: Anti-ESYT1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA016858
Hersteller Artikelnummer: HPA016858
Alternativnummer: ATA-HPA016858-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FAM62A, KIAA0747, MBC2
extended synaptotagmin-like protein 1
Anti-ESYT1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 23344
UniProt: Q9BSJ8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LEVEVFDKDLDKDDFLGRCKVRLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQTSAPVWDESASFLIRKPHTE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ESYT1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.
Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphocytes.
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ESYT1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA016858
HPA016858
HPA016858