Anti-ESYT1
Artikelnummer:
ATA-HPA016858
- Bilder (9)
| Artikelname: | Anti-ESYT1 |
| Artikelnummer: | ATA-HPA016858 |
| Hersteller Artikelnummer: | HPA016858 |
| Alternativnummer: | ATA-HPA016858-100,ATA-HPA016858-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FAM62A, KIAA0747, MBC2 |
| extended synaptotagmin-like protein 1 |
| Anti-ESYT1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23344 |
| UniProt: | Q9BSJ8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LEVEVFDKDLDKDDFLGRCKVRLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQTSAPVWDESASFLIRKPHTE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ESYT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphocytes. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli. |
|
|
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ESYT1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA016858-100ul |
|
|
|
|
|
HPA016858-100ul |
|
|
HPA016858-100ul |
Produktgarantie und fachkundiger Support
