Anti-ESYT1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ESYT1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA016858
• Supplier Catalog Number: HPA016858
• Alternative Catalog Number: ATA-HPA016858-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FAM62A, KIAA0747, MBC2

Product Description

extended synaptotagmin-like protein 1

Additional Information

Anti-ESYT1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 23344
• UniProt: Q9BSJ8
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LEVEVFDKDLDKDDFLGRCKVRLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQTSAPVWDESASFLIRKPHTE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ESYT1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.

Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphocytes.

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.

Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ESYT1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

HPA016858

HPA016858

HPA016858