Anti-ESYT1

Catalog Number: ATA-HPA016858
Article Name: Anti-ESYT1
Biozol Catalog Number: ATA-HPA016858
Supplier Catalog Number: HPA016858
Alternative Catalog Number: ATA-HPA016858-100,ATA-HPA016858-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FAM62A, KIAA0747, MBC2
extended synaptotagmin-like protein 1
Anti-ESYT1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 23344
UniProt: Q9BSJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LEVEVFDKDLDKDDFLGRCKVRLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQTSAPVWDESASFLIRKPHTE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ESYT1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.
Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphocytes.
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ESYT1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA016858-100ul
HPA016858-100ul
HPA016858-100ul