Anti-AFM Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA017006
Artikelname: Anti-AFM Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA017006
Hersteller Artikelnummer: HPA017006
Alternativnummer: ATA-HPA017006-100,ATA-HPA017006-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ALB2, ALBA
afamin
Anti-AFM
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 173
UniProt: P43652
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: INSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEEL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: AFM
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000
Immunohistochemical staining of human colon, kidney, liver and lymph node using Anti-AFM antibody HPA017006 (A) shows similar protein distribution across tissues to independent antibody HPA052437 (B).
Immunohistochemical staining of human colon using Anti-AFM antibody HPA017006.
Immunohistochemical staining of human kidney using Anti-AFM antibody HPA017006.
Immunohistochemical staining of human liver using Anti-AFM antibody HPA017006.
Immunohistochemical staining of human lymph node using Anti-AFM antibody HPA017006.
HPA017006
HPA017006
HPA017006