Anti-AFM Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-AFM Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA017006
• Supplier Catalog Number: HPA017006
• Alternative Catalog Number: ATA-HPA017006-100,ATA-HPA017006-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ALB2, ALBA

Product Description

afamin

Additional Information

Anti-AFM

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 173
• UniProt: P43652
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: INSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEEL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: AFM
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:2500 - 1:5000

Images

Immunohistochemical staining of human colon, kidney, liver and lymph node using Anti-AFM antibody HPA017006 (A) shows similar protein distribution across tissues to independent antibody HPA052437 (B).

Immunohistochemical staining of human colon using Anti-AFM antibody HPA017006.

Immunohistochemical staining of human kidney using Anti-AFM antibody HPA017006.

Immunohistochemical staining of human liver using Anti-AFM antibody HPA017006.

Immunohistochemical staining of human lymph node using Anti-AFM antibody HPA017006.

HPA017006

HPA017006

HPA017006