Anti-AFM

Catalog Number: ATA-HPA017006
Article Name: Anti-AFM
Biozol Catalog Number: ATA-HPA017006
Supplier Catalog Number: HPA017006
Alternative Catalog Number: ATA-HPA017006-100,ATA-HPA017006-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ALB2, ALBA
afamin
Anti-AFM
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 173
UniProt: P43652
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: INSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEEL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: AFM
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:2500 - 1:5000
Immunohistochemical staining of human colon, kidney, liver and lymph node using Anti-AFM antibody HPA017006 (A) shows similar protein distribution across tissues to independent antibody HPA052437 (B).
Immunohistochemical staining of human colon using Anti-AFM antibody HPA017006.
Immunohistochemical staining of human kidney using Anti-AFM antibody HPA017006.
Immunohistochemical staining of human liver using Anti-AFM antibody HPA017006.
Immunohistochemical staining of human lymph node using Anti-AFM antibody HPA017006.
HPA017006-100ul
HPA017006-100ul
HPA017006-100ul