Anti-BST2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA017060
Artikelname: Anti-BST2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA017060
Hersteller Artikelnummer: HPA017060
Alternativnummer: ATA-HPA017060-100,ATA-HPA017060-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD317, tetherin
bone marrow stromal cell antigen 2
Anti-BST2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 684
UniProt: Q10589
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: THLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BST2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus.
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in glomeruli.
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in germinal center cells.
Immunohistochemical staining of human skin shows weak cytoplasmic positivity in epidermal cells.
HPA017060
HPA017060
HPA017060