Anti-BST2

Catalog Number: ATA-HPA017060
Article Name: Anti-BST2
Biozol Catalog Number: ATA-HPA017060
Supplier Catalog Number: HPA017060
Alternative Catalog Number: ATA-HPA017060-100,ATA-HPA017060-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CD317, tetherin
bone marrow stromal cell antigen 2
Anti-BST2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 684
UniProt: Q10589
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: THLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: BST2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus.
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in glomeruli.
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in germinal center cells.
Immunohistochemical staining of human skin shows weak cytoplasmic positivity in epidermal cells.
HPA017060-100ul
HPA017060-100ul
HPA017060-100ul