Anti-BST2 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA017060
- Images (9)
| Article Name: | Anti-BST2 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA017060 |
| Supplier Catalog Number: | HPA017060 |
| Alternative Catalog Number: | ATA-HPA017060-100,ATA-HPA017060-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD317, tetherin |
| bone marrow stromal cell antigen 2 |
| Anti-BST2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 684 |
| UniProt: | Q10589 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | THLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | BST2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in germinal center cells. |
|
|
Immunohistochemical staining of human skin shows weak cytoplasmic positivity in epidermal cells. |
|
|
HPA017060 |
|
|
|
|
|
HPA017060 |
|
|
HPA017060 |
Product Guarantee and Expert Support
