Anti-CAMK4

Artikelnummer: ATA-HPA017206
Artikelname: Anti-CAMK4
Artikelnummer: ATA-HPA017206
Hersteller Artikelnummer: HPA017206
Alternativnummer: ATA-HPA017206-100,ATA-HPA017206-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CaMK-GR
calcium/calmodulin-dependent protein kinase IV
Anti-CAMK4
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 814
UniProt: Q16566
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CAMK4
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebellum shows strong nuclear positivity in cells in granular layer.
Immunohistochemical staining of human skeletal muscle shows low positivity in myocytes as expected.
Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells.
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA017206-100ul
HPA017206-100ul
HPA017206-100ul