Anti-CAMK4
Artikelnummer:
ATA-HPA017206
| Artikelname: |
Anti-CAMK4 |
| Artikelnummer: |
ATA-HPA017206 |
| Hersteller Artikelnummer: |
HPA017206 |
| Alternativnummer: |
ATA-HPA017206-100,ATA-HPA017206-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Sonstiges |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
CaMK-GR |
| calcium/calmodulin-dependent protein kinase IV |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.1 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
814 |
| UniProt: |
Q16566 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
GIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSS |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
CAMK4 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
Immunohistochemical staining of human cerebellum shows strong nuclear positivity in cells in granular layer. |
|
Immunohistochemical staining of human skeletal muscle shows low positivity in myocytes as expected. |
|
Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells. |
|
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons. |
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
HPA017206-100ul |
|
|
|
HPA017206-100ul |
|
HPA017206-100ul |