Anti-CAMK4

Catalog Number: ATA-HPA017206
Article Name: Anti-CAMK4
Biozol Catalog Number: ATA-HPA017206
Supplier Catalog Number: HPA017206
Alternative Catalog Number: ATA-HPA017206-100,ATA-HPA017206-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CaMK-GR
calcium/calmodulin-dependent protein kinase IV
Anti-CAMK4
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 814
UniProt: Q16566
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CAMK4
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebellum shows strong nuclear positivity in cells in granular layer.
Immunohistochemical staining of human skeletal muscle shows low positivity in myocytes as expected.
Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells.
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA017206-100ul
HPA017206-100ul
HPA017206-100ul