Anti-PXYLP1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA017243
Artikelname: Anti-PXYLP1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA017243
Hersteller Artikelnummer: HPA017243
Alternativnummer: ATA-HPA017243-100,ATA-HPA017243-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ACPL2, FLJ23751
2-phosphoxylose phosphatase 1
Anti-PXYLP1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 92370
UniProt: Q8TE99
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: STPKNGMSSKSRKRIMPDPVTEPPVTDPVYEALLYCNIPSVAERSMEGHAPHHFKLVSVHVFIRHGDRYPLYVIPKTKRPEIDCTLVANRKPYHPKLEAFISHMSKGSGASFESPLNSLPLYPNHP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PXYLP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemical staining of human epididymis shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemical staining of human skin shows no positivity in keratinocytes as expected.
Western blot analysis in human cell line MOLT-4.
Western blot analysis in control (vector only transfected HEK293T lysate) and PXYLP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403459).
HPA017243
HPA017243
HPA017243