Anti-PXYLP1

Catalog Number: ATA-HPA017243
Article Name: Anti-PXYLP1
Biozol Catalog Number: ATA-HPA017243
Supplier Catalog Number: HPA017243
Alternative Catalog Number: ATA-HPA017243-100,ATA-HPA017243-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ACPL2, FLJ23751
2-phosphoxylose phosphatase 1
Anti-PXYLP1
Clonality: Polyclonal
Isotype: IgG
NCBI: 92370
UniProt: Q8TE99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: STPKNGMSSKSRKRIMPDPVTEPPVTDPVYEALLYCNIPSVAERSMEGHAPHHFKLVSVHVFIRHGDRYPLYVIPKTKRPEIDCTLVANRKPYHPKLEAFISHMSKGSGASFESPLNSLPLYPNHP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PXYLP1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemical staining of human epididymis shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemical staining of human skin shows no positivity in keratinocytes as expected.
Western blot analysis in human cell line MOLT-4.
Western blot analysis in control (vector only transfected HEK293T lysate) and PXYLP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403459).
HPA017243-100ul
HPA017243-100ul
HPA017243-100ul