Anti-PLXDC2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA017268
Artikelname: Anti-PLXDC2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA017268
Hersteller Artikelnummer: HPA017268
Alternativnummer: ATA-HPA017268-100,ATA-HPA017268-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ14623, TEM7R
plexin domain containing 2
Anti-PLXDC2
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 84898
UniProt: Q6UX71
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: CLQFNRCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEESKEKMCENTEPVETSSRTTTTVGATTTQFRVLTTTRRAVTSQFPTSLPTEDDTKIALHLKDNGASTDDSAAEKKG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PLXDC2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.
Immunohistochemical staining of human Fallopian tube shows strong membranous positivity in glandular cells.
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemical staining of human endometrium shows weak membranous positivity in glandular cells.
Immunohistochemical staining of human lung shows moderate membranous positivity in macrophages.
HPA017268
HPA017268
HPA017268