Anti-PLXDC2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA017268
| Artikelname: |
Anti-PLXDC2 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA017268 |
| Hersteller Artikelnummer: |
HPA017268 |
| Alternativnummer: |
ATA-HPA017268-100,ATA-HPA017268-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ICC, IHC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
FLJ14623, TEM7R |
| plexin domain containing 2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.05 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
84898 |
| UniProt: |
Q6UX71 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
CLQFNRCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEESKEKMCENTEPVETSSRTTTTVGATTTQFRVLTTTRRAVTSQFPTSLPTEDDTKIALHLKDNGASTDDSAAEKKG |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
PLXDC2 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies. |
|
Immunohistochemical staining of human Fallopian tube shows strong membranous positivity in glandular cells. |
|
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells. |
|
Immunohistochemical staining of human endometrium shows weak membranous positivity in glandular cells. |
|
Immunohistochemical staining of human lung shows moderate membranous positivity in macrophages. |
|
HPA017268 |
|
|
|
HPA017268 |
|
HPA017268 |