Anti-PLXDC2

Catalog Number: ATA-HPA017268
Article Name: Anti-PLXDC2
Biozol Catalog Number: ATA-HPA017268
Supplier Catalog Number: HPA017268
Alternative Catalog Number: ATA-HPA017268-100,ATA-HPA017268-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ14623, TEM7R
plexin domain containing 2
Anti-PLXDC2
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 84898
UniProt: Q6UX71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CLQFNRCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEESKEKMCENTEPVETSSRTTTTVGATTTQFRVLTTTRRAVTSQFPTSLPTEDDTKIALHLKDNGASTDDSAAEKKG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PLXDC2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.
Immunohistochemical staining of human Fallopian tube shows strong membranous positivity in glandular cells.
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemical staining of human endometrium shows weak membranous positivity in glandular cells.
Immunohistochemical staining of human lung shows moderate membranous positivity in macrophages.
HPA017268-100ul
HPA017268-100ul
HPA017268-100ul