Anti-PLXDC2 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PLXDC2 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA017268
• Supplier Catalog Number: HPA017268
• Alternative Catalog Number: ATA-HPA017268-100,ATA-HPA017268-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ14623, TEM7R

Product Description

plexin domain containing 2

Additional Information

Anti-PLXDC2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 84898
• UniProt: Q6UX71
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: CLQFNRCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEESKEKMCENTEPVETSSRTTTTVGATTTQFRVLTTTRRAVTSQFPTSLPTEDDTKIALHLKDNGASTDDSAAEKKG
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: PLXDC2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.

Immunohistochemical staining of human Fallopian tube shows strong membranous positivity in glandular cells.

Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells.

Immunohistochemical staining of human endometrium shows weak membranous positivity in glandular cells.

Immunohistochemical staining of human lung shows moderate membranous positivity in macrophages.

HPA017268

HPA017268

HPA017268