Anti-DNER
Artikelnummer:
ATA-HPA017320
- Bilder (7)
| Artikelname: | Anti-DNER |
| Artikelnummer: | ATA-HPA017320 |
| Hersteller Artikelnummer: | HPA017320 |
| Alternativnummer: | ATA-HPA017320-100,ATA-HPA017320-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | bet, UNQ26 |
| delta/notch-like EGF repeat containing |
| Anti-DNER |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 92737 |
| UniProt: | Q8NFT8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLWKVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTLVVKVSTCVPGESHANDLECSGKGKCTTKP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DNER |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected. |
|
|
Immunohistochemical staining of human small intestine shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA017320-100ul |
|
|
HPA017320-100ul |
|
|
HPA017320-100ul |
Produktgarantie und fachkundiger Support
