Anti-DNER

Catalog Number: ATA-HPA017320
Article Name: Anti-DNER
Biozol Catalog Number: ATA-HPA017320
Supplier Catalog Number: HPA017320
Alternative Catalog Number: ATA-HPA017320-100,ATA-HPA017320-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bet, UNQ26
delta/notch-like EGF repeat containing
Anti-DNER
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 92737
UniProt: Q8NFT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLWKVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTLVVKVSTCVPGESHANDLECSGKGKCTTKP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DNER
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemical staining of human small intestine shows no positivity in glandular cells as expected.
Immunohistochemical staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA017320-100ul
HPA017320-100ul
HPA017320-100ul