Anti-DNER
Catalog Number:
ATA-HPA017320
- Images (7)
| Article Name: | Anti-DNER |
| Biozol Catalog Number: | ATA-HPA017320 |
| Supplier Catalog Number: | HPA017320 |
| Alternative Catalog Number: | ATA-HPA017320-100,ATA-HPA017320-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | bet, UNQ26 |
| delta/notch-like EGF repeat containing |
| Anti-DNER |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 92737 |
| UniProt: | Q8NFT8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLWKVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTLVVKVSTCVPGESHANDLECSGKGKCTTKP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DNER |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected. |
|
|
Immunohistochemical staining of human small intestine shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA017320-100ul |
|
|
HPA017320-100ul |
|
|
HPA017320-100ul |
Product Guarantee and Expert Support
