Anti-LEMD2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA017340
Artikelname: Anti-LEMD2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA017340
Hersteller Artikelnummer: HPA017340
Alternativnummer: ATA-HPA017340-100,ATA-HPA017340-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: dJ482C21.1, NET25
LEM domain containing 2
Anti-LEMD2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 221496
UniProt: Q8NC56
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCIPVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTVDKVVCLESAHP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LEMD2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane.
Immunohistochemical staining of human skin shows nuclear membranous positivity in epidermal cells.
Western blot analysis in human cell line HeLa.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA017340
HPA017340
HPA017340