Anti-LEMD2

Catalog Number: ATA-HPA017340
Article Name: Anti-LEMD2
Biozol Catalog Number: ATA-HPA017340
Supplier Catalog Number: HPA017340
Alternative Catalog Number: ATA-HPA017340-100,ATA-HPA017340-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: dJ482C21.1, NET25
LEM domain containing 2
Anti-LEMD2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 221496
UniProt: Q8NC56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCIPVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTVDKVVCLESAHP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LEMD2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane.
Immunohistochemical staining of human skin shows nuclear membranous positivity in epidermal cells.
Western blot analysis in human cell line HeLa.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA017340-100ul
HPA017340-100ul
HPA017340-100ul