Anti-LEMD2 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-LEMD2 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA017340
• Supplier Catalog Number: HPA017340
• Alternative Catalog Number: ATA-HPA017340-100,ATA-HPA017340-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: dJ482C21.1, NET25

Product Description

LEM domain containing 2

Additional Information

Anti-LEMD2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 221496
• UniProt: Q8NC56
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: EDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCIPVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTVDKVVCLESAHP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: LEMD2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane.

Immunohistochemical staining of human skin shows nuclear membranous positivity in epidermal cells.

Western blot analysis in human cell line HeLa.

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

HPA017340

HPA017340

HPA017340