Anti-RSPH1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA017382
Artikelname: Anti-RSPH1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA017382
Hersteller Artikelnummer: HPA017382
Alternativnummer: ATA-HPA017382-100,ATA-HPA017382-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CILD24, FLJ32753, RSP44, RSPH10A, TSGA2
radial spoke head 1 homolog (Chlamydomonas)
Anti-RSPH1
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 89765
UniProt: Q8WYR4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RSPH1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human fallopian tube and placenta tissues using Anti-RSPH1 antibody. Corresponding RSPH1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, fallopian tube, placenta and testis using Anti-RSPH1 antibody HPA017382 (A) shows similar protein distribution across tissues to independent antibody HPA016816 (B).
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human placenta shows low expression as expected.
Immunohistochemical staining of human cerebral cortex using Anti-RSPH1 antibody HPA017382.
Immunohistochemical staining of human testis using Anti-RSPH1 antibody HPA017382.
HPA017382
HPA017382
HPA017382