Anti-RSPH1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-RSPH1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA017382
• Supplier Catalog Number: HPA017382
• Alternative Catalog Number: ATA-HPA017382-100,ATA-HPA017382-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CILD24, FLJ32753, RSP44, RSPH10A, TSGA2

Product Description

radial spoke head 1 homolog (Chlamydomonas)

Additional Information

Anti-RSPH1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 89765
• UniProt: Q8WYR4
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: RSPH1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human fallopian tube and placenta tissues using Anti-RSPH1 antibody. Corresponding RSPH1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, fallopian tube, placenta and testis using Anti-RSPH1 antibody HPA017382 (A) shows similar protein distribution across tissues to independent antibody HPA016816 (B).

Immunohistochemical staining of human fallopian tube shows high expression.

Immunohistochemical staining of human placenta shows low expression as expected.

Immunohistochemical staining of human cerebral cortex using Anti-RSPH1 antibody HPA017382.

Immunohistochemical staining of human testis using Anti-RSPH1 antibody HPA017382.

HPA017382

HPA017382

HPA017382