Anti-RSPH1

Catalog Number: ATA-HPA017382
Article Name: Anti-RSPH1
Biozol Catalog Number: ATA-HPA017382
Supplier Catalog Number: HPA017382
Alternative Catalog Number: ATA-HPA017382-100,ATA-HPA017382-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CILD24, FLJ32753, RSP44, RSPH10A, TSGA2
radial spoke head 1 homolog (Chlamydomonas)
Anti-RSPH1
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 89765
UniProt: Q8WYR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RSPH1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human fallopian tube and placenta tissues using Anti-RSPH1 antibody. Corresponding RSPH1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, fallopian tube, placenta and testis using Anti-RSPH1 antibody HPA017382 (A) shows similar protein distribution across tissues to independent antibody HPA016816 (B).
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human placenta shows low expression as expected.
Immunohistochemical staining of human cerebral cortex using Anti-RSPH1 antibody HPA017382.
Immunohistochemical staining of human testis using Anti-RSPH1 antibody HPA017382.
HPA017382-100ul
HPA017382-100ul
HPA017382-100ul