Anti-CTPS2

Artikelnummer: ATA-HPA017437
Artikelname: Anti-CTPS2
Artikelnummer: ATA-HPA017437
Hersteller Artikelnummer: HPA017437
Alternativnummer: ATA-HPA017437-100,ATA-HPA017437-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CTPS2
CTP synthase 2
Anti-CTPS2
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 56474
UniProt: Q9NRF8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GVCLGMQLAVIEFARNCLNLKDADSTEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFVGQDVDGD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CTPS2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.
Western blot analysis in human cell line HEK 293.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA017437-100ul
HPA017437-100ul
HPA017437-100ul