Anti-CTPS2 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CTPS2 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA017437
• Supplier Catalog Number: HPA017437
• Alternative Catalog Number: ATA-HPA017437-100,ATA-HPA017437-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human, Rat
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CTPS2

Product Description

CTP synthase 2

Additional Information

Anti-CTPS2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 56474
• UniProt: Q9NRF8
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: GVCLGMQLAVIEFARNCLNLKDADSTEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFVGQDVDGD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CTPS2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemical staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.

Western blot analysis in human cell line HEK 293.

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

HPA017437

HPA017437

HPA017437