Anti-CTPS2 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA017437
Article Name: Anti-CTPS2 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA017437
Supplier Catalog Number: HPA017437
Alternative Catalog Number: ATA-HPA017437-100,ATA-HPA017437-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CTPS2
CTP synthase 2
Anti-CTPS2
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 56474
UniProt: Q9NRF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GVCLGMQLAVIEFARNCLNLKDADSTEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFVGQDVDGD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CTPS2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.
Western blot analysis in human cell line HEK 293.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA017437
HPA017437
HPA017437