Anti-MARC2

Artikelnummer: ATA-HPA017572
Artikelname: Anti-MARC2
Artikelnummer: ATA-HPA017572
Hersteller Artikelnummer: HPA017572
Alternativnummer: ATA-HPA017572-100,ATA-HPA017572-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ20605, MOSC2
mitochondrial amidoxime reducing component 2
Anti-MARC2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 54996
UniProt: Q969Z3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RFWLVIKEDGHMVTARQEPRLVLISIIYENNCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MARC2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human parathyroid gland and lymph node tissues using Anti-MARC2 antibody. Corresponding MARC2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, kidney, lymph node and parathyroid gland using Anti-MARC2 antibody HPA017572 (A) shows similar protein distribution across tissues to independent antibody HPA015085 (B).
Immunohistochemical staining of human parathyroid gland shows high expression.
Immunohistochemical staining of human lymph node shows low expression as expected.
Immunohistochemical staining of human kidney using Anti-MARC2 antibody HPA017572.
Immunohistochemical staining of human cerebral cortex using Anti-MARC2 antibody HPA017572.
HPA017572-100ul
HPA017572-100ul
HPA017572-100ul