Anti-MARC2 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-MARC2 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA017572
• Supplier Catalog Number: HPA017572
• Alternative Catalog Number: ATA-HPA017572-100,ATA-HPA017572-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ20605, MOSC2

Product Description

mitochondrial amidoxime reducing component 2

Additional Information

Anti-MARC2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 54996
• UniProt: Q969Z3
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: RFWLVIKEDGHMVTARQEPRLVLISIIYENNCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: MARC2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human parathyroid gland and lymph node tissues using Anti-MARC2 antibody. Corresponding MARC2 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, kidney, lymph node and parathyroid gland using Anti-MARC2 antibody HPA017572 (A) shows similar protein distribution across tissues to independent antibody HPA015085 (B).

Immunohistochemical staining of human parathyroid gland shows high expression.

Immunohistochemical staining of human lymph node shows low expression as expected.

Immunohistochemical staining of human kidney using Anti-MARC2 antibody HPA017572.

Immunohistochemical staining of human cerebral cortex using Anti-MARC2 antibody HPA017572.

HPA017572

HPA017572

HPA017572