Anti-SNX14
Artikelnummer:
ATA-HPA017639
- Bilder (7)
| Artikelname: | Anti-SNX14 |
| Artikelnummer: | ATA-HPA017639 |
| Hersteller Artikelnummer: | HPA017639 |
| Alternativnummer: | ATA-HPA017639-100,ATA-HPA017639-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RGS-PX2 |
| sorting nexin 14 |
| Anti-SNX14 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 57231 |
| UniProt: | Q9Y5W7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LFRFMNFLKQEGAVHVLQFCLTVEEFNDRILRPELSNDEMLSLHEELQKIYKTYCLDESIDKIRFDPFIVEEIQRIAEGPYIDVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRGAESPTRN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SNX14 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell line THP-1. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA017639-100ul |
|
|
|
|
|
HPA017639-100ul |
|
|
HPA017639-100ul |
Produktgarantie und fachkundiger Support
