Anti-SNX14
Catalog Number:
ATA-HPA017639
- Images (7)
| Article Name: | Anti-SNX14 |
| Biozol Catalog Number: | ATA-HPA017639 |
| Supplier Catalog Number: | HPA017639 |
| Alternative Catalog Number: | ATA-HPA017639-100,ATA-HPA017639-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | RGS-PX2 |
| sorting nexin 14 |
| Anti-SNX14 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 57231 |
| UniProt: | Q9Y5W7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LFRFMNFLKQEGAVHVLQFCLTVEEFNDRILRPELSNDEMLSLHEELQKIYKTYCLDESIDKIRFDPFIVEEIQRIAEGPYIDVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRGAESPTRN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SNX14 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell line THP-1. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA017639-100ul |
|
|
|
|
|
HPA017639-100ul |
|
|
HPA017639-100ul |
Product Guarantee and Expert Support
