Anti-PRSS16
Artikelnummer:
ATA-HPA017743
- Bilder (8)
| Artikelname: | Anti-PRSS16 |
| Artikelnummer: | ATA-HPA017743 |
| Hersteller Artikelnummer: | HPA017743 |
| Alternativnummer: | ATA-HPA017743-100,ATA-HPA017743-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TSSP |
| protease, serine, 16 (thymus) |
| Anti-PRSS16 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10279 |
| UniProt: | Q9NQE7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPALPSQLDLCEQVFGLSALSVAQAVAQTNSYYGG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PRSS16 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human thymus shows moderate to strong positivity in cortical epithelial cells. |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in chief cells. |
|
|
Immunohistochemical staining of human skin shows weak to moderate granular cytoplasmic positivity in stratum basale. |
|
|
Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected. |
|
|
HPA017743-100ul |
|
|
HPA017743-100ul |
|
|
HPA017743-100ul |
Produktgarantie und fachkundiger Support
