Anti-PRSS16
Catalog Number:
ATA-HPA017743
- Images (8)
| Article Name: | Anti-PRSS16 |
| Biozol Catalog Number: | ATA-HPA017743 |
| Supplier Catalog Number: | HPA017743 |
| Alternative Catalog Number: | ATA-HPA017743-100,ATA-HPA017743-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | TSSP |
| protease, serine, 16 (thymus) |
| Anti-PRSS16 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 10279 |
| UniProt: | Q9NQE7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPALPSQLDLCEQVFGLSALSVAQAVAQTNSYYGG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PRSS16 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human thymus shows moderate to strong positivity in cortical epithelial cells. |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in chief cells. |
|
|
Immunohistochemical staining of human skin shows weak to moderate granular cytoplasmic positivity in stratum basale. |
|
|
Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected. |
|
|
HPA017743-100ul |
|
|
HPA017743-100ul |
|
|
HPA017743-100ul |
Product Guarantee and Expert Support
