Anti-COL15A1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA017915
Artikelname: Anti-COL15A1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA017915
Hersteller Artikelnummer: HPA017915
Alternativnummer: ATA-HPA017915-100,ATA-HPA017915-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: COL15A1
collagen, type XV, alpha 1
Anti-COL15A1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 1306
UniProt: P39059
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASGVPTDGLAPLTATMAPERAVTSGPGDEEDLAAA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: COL15A1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human placenta and liver tissues using Anti-COL15A1 antibody. Corresponding COL15A1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney, liver, placenta and testis using Anti-COL15A1 antibody HPA017915 (A) shows similar protein distribution across tissues to independent antibody HPA017913 (B).
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human testis using Anti-COL15A1 antibody HPA017915.
Immunohistochemical staining of human kidney using Anti-COL15A1 antibody HPA017915.
HPA017915
HPA017915
HPA017915