Anti-COL15A1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-COL15A1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA017915
• Supplier Catalog Number: HPA017915
• Alternative Catalog Number: ATA-HPA017915-100,ATA-HPA017915-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: COL15A1

Product Description

collagen, type XV, alpha 1

Additional Information

Anti-COL15A1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 1306
• UniProt: P39059
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: MPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASGVPTDGLAPLTATMAPERAVTSGPGDEEDLAAA
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: COL15A1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human placenta and liver tissues using Anti-COL15A1 antibody. Corresponding COL15A1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human kidney, liver, placenta and testis using Anti-COL15A1 antibody HPA017915 (A) shows similar protein distribution across tissues to independent antibody HPA017913 (B).

Immunohistochemical staining of human placenta shows high expression.

Immunohistochemical staining of human liver shows low expression as expected.

Immunohistochemical staining of human testis using Anti-COL15A1 antibody HPA017915.

Immunohistochemical staining of human kidney using Anti-COL15A1 antibody HPA017915.

HPA017915

HPA017915

HPA017915