Anti-COL15A1

Catalog Number: ATA-HPA017915
Article Name: Anti-COL15A1
Biozol Catalog Number: ATA-HPA017915
Supplier Catalog Number: HPA017915
Alternative Catalog Number: ATA-HPA017915-100,ATA-HPA017915-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: COL15A1
collagen, type XV, alpha 1
Anti-COL15A1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1306
UniProt: P39059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASGVPTDGLAPLTATMAPERAVTSGPGDEEDLAAA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: COL15A1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human placenta and liver tissues using Anti-COL15A1 antibody. Corresponding COL15A1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney, liver, placenta and testis using Anti-COL15A1 antibody HPA017915 (A) shows similar protein distribution across tissues to independent antibody HPA017913 (B).
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human testis using Anti-COL15A1 antibody HPA017915.
Immunohistochemical staining of human kidney using Anti-COL15A1 antibody HPA017915.
HPA017915-100ul
HPA017915-100ul
HPA017915-100ul