Anti-SPAM1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA017984
Artikelname: Anti-SPAM1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA017984
Hersteller Artikelnummer: HPA017984
Alternativnummer: ATA-HPA017984-100,ATA-HPA017984-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HYAL5, PH-20, SPAG15
sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding)
Anti-SPAM1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 6677
UniProt: P38567
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPM
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SPAM1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and liver tissues using HPA017984 antibody. Corresponding SPAM1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemical staining of human testis shows moderate membranous/cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and SPAM1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401088).
HPA017984
HPA017984
HPA017984